Loading...
Statistics
Advertisement

Home
www.edlax.uk/
Fine Art by Ed Lax

Edlax.uk

Domain is redirected to: Edlax.co.uk
Advertisement
Conversion Technology Metas Server
Edlax.uk is hosted in United Kingdom . Edlax.uk uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Flexslider, Google Font API, Number of used javascripts: 22. First javascripts: Jquery.min.js, Jquery-noconflict.js, Jquery-migrate.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Edlax.uk

Technology

Number of occurences: 8
  • CSS
  • Flexslider
  • Google Font API
  • Html
  • Html5
  • Javascript
  • jQuery Fancybox
  • Php

Advertisement

Javascripts

Number of occurences: 22
  • jquery.min.js
  • jquery-noconflict.js
  • jquery-migrate.min.js
  • tabs-state.js
  • mootools-core.js
  • core.js
  • caption.js
  • jquery-1.9.1.min.js
  • jquery-easing-1.3.js
  • modernizr.js
  • retina.js
  • jquery.isotope.min.js
  • jquery.ba-bbq.min.js
  • jquery.isotope.load_home.js
  • input.fields.js
  • responsive-nav.js
  • jquery.flexslider-min.js
  • jquery.fancybox.pack.js
  • image-hover.js
  • scrollup.js
  • preloader.js
  • mousewheel.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Edlax.uk

SSL certificate

    • name: /CN=edlax.uk
    • subject:
      • CN: edlax.uk
    • hash: 6f6b3587
    • issuer:
      • C: US
      • ST: TX
      • L: Houston
      • O: cPanel, Inc.
      • CN: cPanel, Inc. Certification Authority
    • version: 2
    • serialNumber: 25868541231561652172913172639617387478
    • validFrom: 160813000000Z
    • validTo: 161111235959Z
    • validFrom_time_t: 1471046400
    • validTo_time_t: 1478908799
    • extensions:
      • authorityKeyIdentifier: keyid:7E:03:5A:65:41:6B:A7:7E:0A:E1:B8:9D:08:EA:1D:8E:1D:6A:C7:65
      • subjectKeyIdentifier: 6B:60:00:62:44:C8:93:0C:AD:B9:51:C9:4C:27:FB:40:C8:1D:6D:7A
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.52 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/cPanelIncCertificationAuthority.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/cPanelIncCertificationAuthority.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:edlax.uk, DNS:edlax.co.uk, DNS:www.edlax.co.uk, DNS:www.edlax.uk

Meta - Edlax.uk

Number of occurences: 4
  • Name:
    Content: text/html; charset=utf-8
  • Name: description
    Content: Fine Art by Ed Lax
  • Name: generator
    Content: Joomla! - Open Source Content Management
  • Name: viewport
    Content: width=device-width, initial-scale=1, maximum-scale=1

Server / Hosting

  • IP: 78.110.160.2
  • Latitude: 51.50
  • Longitude: -0.12
  • Country: United Kingdom

Rname

  • ns3.bigwetfish.co.uk
  • ns1.bigwetfish.co.uk
  • ns2.bigwetfish.co.uk
  • spamfilter1.bigwetfish.co.uk
  • spamfilter2.bigwetfish.co.uk

Target

  • servernotices.bigwetfish.co.uk

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Fri, 30 Sep 2016 16:46:42 GMT Server: Apache Location: http://edlax.co.uk Content-Length: 226 Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_bd43 Via: 1.1 s_bd43 (squid/3.5.20) Connection: keep-alive HTTP/1.1 301 Moved Permanently Date: Fri, 30 Sep 2016 16:46:42 GMT Server: Apache Location: http://www.edlax.co.uk/ed/ Content-Length: 234 Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_bd43 Via: 1.1 s_bd43 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Date: Fri, 30 Sep 2016 16:46:43 GMT Server: Apache P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Expires: Mon, 1 Jan 2001 00:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: 1b31ba76f2ca7da6a0b765b2c68d6277=8ct1si25um5d25sm341968rlj1; path=/; HttpOnly Last-Modified: Fri, 30 Sep 2016 16:46:43 GMT Vary: Accept-Encoding Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_bd43 Transfer-Encoding: chunked Via: 1.1 s_bd43 (squid/3.5.20) Connection: keep-alive

DNS

host: edlax.uk
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 78.110.160.2
host: edlax.uk
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.bigwetfish.co.uk
host: edlax.uk
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.bigwetfish.co.uk
host: edlax.uk
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.bigwetfish.co.uk
host: edlax.uk
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.bigwetfish.co.uk
  5. rname: servernotices.bigwetfish.co.uk
  6. serial: 2016090503
  7. refresh: 3600
  8. retry: 7200
  9. expire: 1209600
  10. minimum-ttl: 86400
host: edlax.uk
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: spamfilter1.bigwetfish.co.uk
host: edlax.uk
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: spamfilter2.bigwetfish.co.uk

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.dlax.uk, www.exdlax.uk, www.xdlax.uk, www.esdlax.uk, www.sdlax.uk, www.ewdlax.uk, www.wdlax.uk, www.erdlax.uk, www.rdlax.uk, www.efdlax.uk, www.fdlax.uk, www.evdlax.uk, www.vdlax.uk, www.ecdlax.uk, www.cdlax.uk, www.eqdlax.uk, www.qdlax.uk, www.eadlax.uk, www.adlax.uk, www.eydlax.uk, www.ydlax.uk, www.elax.uk, www.edtlax.uk, www.etlax.uk, www.edglax.uk, www.eglax.uk, www.edblax.uk, www.eblax.uk, www.edxlax.uk, www.exlax.uk, www.edslax.uk, www.eslax.uk, www.edflax.uk, www.eflax.uk, www.edvlax.uk, www.evlax.uk, www.edylax.uk, www.eylax.uk, www.edzlax.uk, www.ezlax.uk, www.edalax.uk, www.ealax.uk, www.edelax.uk, www.eelax.uk, www.edrlax.uk, www.erlax.uk, www.edax.uk, www.edluax.uk, www.eduax.uk, www.edl8ax.uk, www.ed8ax.uk, www.edl9ax.uk, www.ed9ax.uk, www.edljax.uk, www.edjax.uk, www.edl0ax.uk, www.ed0ax.uk, www.edlmax.uk, www.edmax.uk, www.edlpax.uk, www.edpax.uk, www.edloax.uk, www.edoax.uk, www.edlx.uk, www.edlaox.uk, www.edlox.uk, www.edlapx.uk, www.edlpx.uk, www.edla9x.uk, www.edl9x.uk, www.edlax.uk, www.edlx.uk, www.edlaix.uk, www.edlix.uk, www.edlaux.uk, www.edlux.uk, www.edla.uk, www.edlaxq.uk, www.edlaq.uk, www.edlax.uk, www.edla.uk, www.edlaxa.uk, www.edlaa.uk, www.edlaxs.uk, www.edlas.uk, www.edlaxd.uk, www.edlad.uk, www.edlaxe.uk, www.edlae.uk,

Other websites we recently analyzed

  1. Mainstagebingo | Home
    Curacao - 190.121.210.6
    Server software: CXLWS
    Technology: CSS, Html, Html5, Javascript, jQuery Cookie, jQuery UI, Php, Swf Object, Google Analytics
    Number of Javascript: 15
    Number of meta tags: 1
  2. Lilabat.com Gros oeuvre & Bâtiment
    France - 213.186.33.40
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Wordpress
    Number of meta tags: 2
  3. Outdoor Bunting | Cheap union jack, birthday bunting for celebrations and lots more
    Germany - 82.165.184.170
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
    Number of meta tags: 3
  4. ippodromolamauramilano.info
    Registrazione e gestione dei domini Internet, i documenti necessari, le ultime estensioni possibili, il listino prezzi completo!
    Italy - 195.110.124.188
    Server software: Apache
    Technology: Html
    Number of meta tags: 3
  5. no-win-no-fee-lawyers.com.au
    Australia - 27.121.64.40
    Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  6. antarvedisrilakshminarasimhaswamy.org
    See related links to what you are looking for.
    New York (United States) - 199.59.243.120
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, Html, Html5, Javascript
    Number of meta tags: 3
  7. wwwpromdresses.com
    New York (United States) - 69.172.201.208
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  8. Concept Egypt reale state - Concept Egypt realestate
    Joomla! - the dynamic portal engine and content management system
    Scottsdale (United States) - 107.180.51.2
    Server software: Apache/2.4.23
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, jQuery UI, Php, Joomla
    Number of Javascript: 30
    Number of meta tags: 7
  9. 151 Technology
    151 Technology
    Scottsdale (United States) - 50.63.202.27
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 2
  10. 沈阳好易施建筑科技开发有限公司
    Hangzhou (China) - 120.24.68.60
    Server software: Apache
    Technology: Html, Javascript, Php, Swf Object
    Number of meta tags: 1

Check Other Websites